PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539048.1_FGP002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 287aa    MW: 29950.2 Da    PI: 6.018
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539048.1_FGP002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS48.71.4e-15137203268
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppse 68 
                         +lL+ecA+av+ +d +++q+l++ l+elasp+gd  q+la+yf+++L arl+ s++++ ++l++ +
  KN539048.1_FGP002 137 AQLLMECARAVAGRDSQRVQQLMWMLNELASPYGDVDQKLASYFLQGLFARLTTSGPRTLRTLAAAS 203
                        589********************************************************99997655 PP

2GRAS37.33.8e-12209268125180
               GRAS 125 WpaLlqaLasRp.egppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnv 180
                        Wp+Ll+aLa+R+ +++p+l iT+v++ ++     ++ ++e+g+rL+kfA+ +gvp + + 
  KN539048.1_FGP002 209 WPTLLEALATRSsDDTPHLSITTVVPTAAPsaaAQRVMREIGQRLEKFARLMGVPSKATH 268
                        ************8889********996655788999******************977666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098513.506110287IPR005202Transcription factor GRAS
PfamPF035144.8E-13137203IPR005202Transcription factor GRAS
PfamPF035141.3E-9209268IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MLATTTAGGL GLDGYPLQGG GGGGGGYYYA EEQQPAAYLE ECGNGHQFYM DEDFSSSSSS  60
RQFHSGTGAP SSAPAPPPPS ATTSSAGGHG LFEAADFSFP QVDISLDFGG SPAVSSSSGA  120
GAGAAPSSSS SSGRWAAQLL MECARAVAGR DSQRVQQLMW MLNELASPYG DVDQKLASYF  180
LQGLFARLTT SGPRTLRTLA AASDRYPSWP TLLEALATRS SDDTPHLSIT TVVPTAAPSA  240
AAQRVMREIG QRLEKFARLM GVPSKATHLS QKIKQETEKN STTKQLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1338610.0AC133861.5 Oryza sativa chromosome 3 BAC OSJNBb0031F05 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629293.13e-87PREDICTED: protein SHORT-ROOT 2
SwissprotA2XIA83e-89SHR2_ORYSI; Protein SHORT-ROOT 2
TrEMBLI1PCJ28e-89I1PCJ2_ORYGL; Uncharacterized protein
STRINGORGLA03G0208800.12e-88(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35263781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.13e-35GRAS family protein